B4galt2 (NM_017377) Mouse Recombinant Protein

SKU
TP515821
Purified recombinant protein of Mouse UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4galt2), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR215821 representing NM_017377
Red=Cloning site Green=Tags(s)

MSRLLGGTLERVCKAVLLLCLLHFLVAVILYFDVYAQHLAFFSRFSTRSPAHALYPAASSSTNCSRPNAT
AASSGLPEVPSARPGPTAPVIPPCPDVPPGLVGRVVIEFTSPMPLERVQRENPGVLLGGRYSPPDCTPAQ
TVAVIIPFRHREHHLRYWLHYLHPMLRRQRLRYGVYVINQHGEETFNRAKLLNVGFLEALKEDAAYDCFI
FSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYASYFGGVSGLSKAQFLRINGFPNEYWGWGGEDD
DIFNRISLTGMKISRPDVRIGRYRMIKHDRDKHNEPNPQRFNKIQNTKMSMKWDGIGSVRYRVLEVSRQP
LFTNITVDIGQPMSWLTQG

myc-FLAG tag
Tag Myc-DDK
Predicted MW 42.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_059073
Locus ID 53418
UniProt ID Q9Z2Y2
Cytogenetics 4 D2.1
RefSeq Size 2432
RefSeq ORF 1107
Synonyms Ggtb2
Summary Responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids. Can produce lactose (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:B4galt2 (NM_017377) Mouse Recombinant Protein
Your Rating
SKU Description Size Price
LC715821 B4galt2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY715821 Transient overexpression lysate of Mouse UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4galt2) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.