Cyp4x1 (NM_001003947) Mouse Recombinant Protein

SKU
TP515201
Purified recombinant protein of Mouse cytochrome P450, family 4, subfamily x, polypeptide 1 (Cyp4x1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR215201 representing NM_001003947
Red=Cloning site Green=Tags(s)

MEASWLETRWARPLHLALVFCLALVLMQAMKLYLRRQRLLRDLSPFPGPPAHWLLGHQKFLQEDNMETLD
EIVKKHPCAFPCWVGPFQAFFYIYDPDYAKIFLSRTDPKMQYLHQLLTPCIGRGLLNLDGPRWFQHRCLL
TPAFHQDILKPCVDTMAHSVKVMLDKWEKMWTTQETTIEVFEHINLMTLDIIMKCAFGQETNCQINGTYE
SYVKATFELGEIISSRLYNFWHHHDIIFKLSPKGHCFQELGKVIHQYTEKIIQDRKKILKNQVKQDDTQT
SQIFLDIVLSAQAEDERAFSDADLRAEVNTFMWAGHDASAASISWLLYCLALNPEHQDRCRTEIRSILGD
GSSITWEQLDEMSYTTMCIKETLRLIPPVPSISRELSKPLTLPDGHSLPAGMTVVLSIWGLHHNPAVWND
PKVFDPLRFTKENSDQRHPCAFLPFSSGPRNCIGQQFAMLELKVAIALILLHFQVAPDLTRPPAFSSHTV
LRPKHGIYLHLKKLLEC

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 59 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001003947
Locus ID 81906
UniProt ID Q6A152
Cytogenetics 4 D1
RefSeq Size 1524
RefSeq ORF 1521
Synonyms A230025G20; Cyp4a28-ps; CYPIVX1; CYP_a
Summary A cytochrome P450 monooxygenase that selectively catalyzes the epoxidation of the last double bond of the arachidonoyl moiety of anandamide, potentially modulating endocannabinoid signaling. Has no hydroxylase activity toward various fatty acids, steroids and prostaglandins. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Cyp4x1 (NM_001003947) Mouse Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.