Stxbp4 (BC032881) Mouse Recombinant Protein

SKU
TP508536
Purified recombinant protein of Mouse syntaxin binding protein 4 (cDNA clone MGC:41138 IMAGE:1224878), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR208536 protein sequence
Red=Cloning site Green=Tags(s)

MSDGTASARSSSPLDRDPAFRVITVTKETGLGLKILGGINRNEGPLVYIHEVIPGGDCYKDGRLKPGDQL
VSINKESMIGVSFEEAKSIITRAKLRSESPWEIAFIRQKSYCGHPGNICCPSPQVSEDCGPQTSTFTLLS
SPSETLLPKTSSTPQTQDSTFPSCKAIQTKPEHDKTEHSPITSLDNSPADTSNADIAPAWTDDDSGPQGK
ISLNPSVRLKAEKLEMALNYLGIQPTKEQREALREQVQADSKGTVSFGDFVQVARSLFCLQLDEVNVGVH
EIPSILDSQLLPCDSLEADEVGKLRQERNAALEERNVLKEKLLESEKHRKQLIEELQNVKQEAKAVAEET
RALRSRIHLAEAAQRQAHGMEMDYEEVIRLLEAEVSELKAQLADYSDQNKESVQDLRKRVTVLDCQLRKS
EMARKAFKASTERLLGFIEAIQEVLLDSSAPLSTLSERRAVLASQTSLPLLARNGRSFPATLLLESKELV
RSVRAILDMDCKLSLSSSSSPSSSSSFSSSSSCNLLNKAEERP

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 58.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
Locus ID 20913
UniProt ID Q9WV89
Cytogenetics 11 D
RefSeq Size 1807
RefSeq ORF 1600
Synonyms 6030470M02Rik; Synip
Summary Plays a role in the translocation of transport vesicles from the cytoplasm to the plasma membrane. Inhibits the translocation of SLC2A4 from intracellular vesicles to the plasma membrane by STX4A binding and preventing the interaction between STX4A and VAMP2. Stimulation with insulin disrupts the interaction with STX4A, leading to increased levels of SLC2A4 at the plasma membrane. May also play a role in the regulation of insulin release by pancreatic beta cells after stimulation by glucose.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Stxbp4 (BC032881) Mouse Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.