Hspa14 (NM_015765) Mouse Recombinant Protein

SKU
TP508190
Purified recombinant protein of Mouse heat shock protein 14 (Hspa14), transcript variant 1, full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR208190 representing NM_015765
Red=Cloning site Green=Tags(s)

MAAIGVHLGCTSACVAVYKDGRADVVANDAGDRVTPAIVAYSEREQVVGLAAKQSRIRHVSSTVVKVKQI
LGRSSADPQAQKYISESKCLVIEKNGKLRYEIDTGEETKLVNPEDVARLIFSKMKETAHSVLGSDANDVV
VTVPFDFGEKQKSALGEAAGAAGFNVLRLIHEPSAALLAYGIGQDHPTGKSNVLVFKLGGTSLSLSVMEV
NSGMYRVLSTNTSDNIGGAHFTDTLAQYLASEFQRLFKHDVRGNARAMMKLMNSAEVAKHSLSTLGSANC
FVDSLYEGQDFDCNVSRARFELLCSPLFNKCTEAIRELLRQTGFTADDINKVVLCGGSSRIPKLQQLIKD
LFPAVDLLNSIPPDEVIPIGAAIEAGILVGKESTSGDDSVMIECSAKDILVKGVDESGADRFTVLFPSGT
PLPARRQHTLQAPGRVSSVCLELYESEGKNSAKEEAKFAQVVLQDLDKKENGLRDILAVLTMKRDGSLQV
TCTDQDTGKCEAITVEVAS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 54.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for at least 3 months from receipt of products under proper storage and handling conditions.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_056580
Locus ID 50497
UniProt ID Q99M31
Cytogenetics 2 A1
RefSeq Size 1791
RefSeq ORF 1527
Synonyms 70kDa; Hsp70-4; HSP70L1; hsr.1; NST-1
Summary Component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, binds to the nascent polypeptide chain, while DNAJC2 stimulates its ATPase activity (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Hspa14 (NM_015765) Mouse Recombinant Protein
Your Rating
SKU Description Size Price
LC708190 Hspa14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY708190 Transient overexpression lysate of Mouse heat shock protein 14 (Hspa14), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.