Sept6 (BC010489) Mouse Recombinant Protein

SKU
TP506812
Purified recombinant protein of Mouse septin 6 (cDNA clone MGC:19033 IMAGE:4168214), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR206812 protein sequence
Red=Cloning site Green=Tags(s)

MAAADIARQVGEDCRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGE
PATHTQPGVQLQSNTYDLQESNVGLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKIRRVL
HSYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPVIAKSDAISKSELAKFKIKITSELVSNGV
QIYQFPTDDESVSEINGTMNAHLPFAVVGSTEEVKIGNKMMRARQYPWGTVQVENEAHCDFVKLREMLIR
VNMEDLREQTHARHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRV
KEKEAELKEAEKELHEKFDRLKKLHQEEKKKLEDKKKCLDEEMNAFKQRKAAAELLQSQGSQAGGSQTLK
RDKEKKN

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 48.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
Locus ID 56526
UniProt ID Q9R1T4
Cytogenetics X A3.3
RefSeq Size 2126
RefSeq ORF 1281
Synonyms 2810035H17Rik; C920001C06Rik; mKIAA0128; Sep6
Summary Filament-forming cytoskeletal GTPase. Required for normal organization of the actin cytoskeleton. Involved in cytokinesis. Forms a filamentous structure with SEPTIN12, SEPTIN6, SEPTIN2 and probably SEPTIN4 at the sperm annulus which is required for the structural integrity and motility of the sperm tail during postmeiotic differentiation (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Sept6 (BC010489) Mouse Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.