Entpd5 (NM_001026214) Mouse Recombinant Protein

SKU TP506800

Purified recombinant protein of Mouse ectonucleoside triphosphate diphosphohydrolase 5 (Entpd5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206800 protein sequence; Red=Cloning site Green=Tags(s); ; MATSWGAVFMLIIACVGSTVFYREQQTWFEGVFLSSMCPINVSAGTFYGIMFDAGSTGTRIHVYTFVQKT; AGQLPFLEGEIFDSVKPGLSAFVDQPKQGAETVQELLEVAKDSIPRSHWERTPVVLKATAGLRLLPEQKA; QALLLEVEEIFKNSPFLVPDGSVSIMDGSYEGILAWVTVNFLTGQLHGRGQETVGTLDLGGASTQITFLP; QFEKTLEQTPRGYLTSFEMFNSTFKLYTHSYLGFGLKAARLATLGALEAKGTDGHTFRSACLPRWLEAEW; IFGGVKYQYGGNQEGEMGFEPCYAEVLRVVQGKLHQPEEVRGSAFYAFSYYYDRAADTHLIDYEKGGVLK; VEDFERKAREVCDNLGSFSSGSPFLCMDLTYITALLKDGFGFADGTLLQLTKKVNNIETGWALGATFHLL; QSLGITS; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 47.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001021385
• Locus ID: 12499
• UniProt ID: Q9WUZ9
• Cytogenetics: 12 39.18 cM
• RefSeq Size: 4987
• RefSeq ORF: 1281
• Synonyms: AI196558; AI987697; Cd39l4; ER-UDPase; mNTPase; NTPDase-5; NTPDase5; Pcph
• Summary: Uridine diphosphatase (UDPase) that promotes protein N-glycosylation and ATP level regulation. UDP hydrolysis promotes protein N-glycosylation and folding in the endoplasmic reticulum, as well as elevated ATP consumption in the cytosol via an ATP hydrolysis cycle. Together with CMPK1 and AK1, constitutes an ATP hydrolysis cycle that converts ATP to AMP and results in a compensatory increase in aerobic glycolysis. The nucleotide hydrolyzing preference is GDP > IDP > UDP, but not any other nucleoside di-, mono- or triphosphates, nor thiamine pyrophosphate. Plays a key role in the AKT1-PTEN signaling pathway by promoting glycolysis in proliferating cells in response to phosphoinositide 3-kinase (PI3K) signaling.[UniProtKB/Swiss-Prot Function]