Abhd3 (NM_134130) Mouse Recombinant Protein
SKU
TP506458
Purified recombinant protein of Mouse abhydrolase domain containing 3 (Abhd3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Mouse |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>MR206458 representing NM_134130
Red=Cloning site Green=Tags(s) MQRLAMDLRVLSRELALYLEHQVRVGFFGSGVGLSLILGFSVAYACYYLSSIAKKPQLVIGGESFSRFLQ DHCPVVTETYYPTVWCWESRGQTLLRPFITSKPPVQYRNELIKTADGGQISLDWFDNNNSAYYVDASTRP TILLLPGLTGTSKESYILHMIHLSEELGYRCVVFNNRGVAGESLLTPRTYCCANTEDLEAVVHHVHSLYP GAPFLAAGVSMGGMLLLNYLGKIGSKTPLMAAATFSVGWNTFACSESLERPLNWLLFNYYLTTCLQSSVK KHRHMFVEQIDMDQVMKAKSIREFDKRFTAVMFGYRTLDDYYTDASPNRRLKSVGIPVLCLNATDDVFSP SHAIPIETAKQNPNVALVLTAYGGHIGFLEGIWPRQCTYMDRVFKQFVQAMVEHGHELSNM myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 46.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_598891 |
Locus ID | 106861 |
UniProt ID | Q91ZH7 |
Cytogenetics | 18 A1 |
RefSeq Size | 1903 |
RefSeq ORF | 1233 |
Synonyms | AA675331; LABH3 |
Summary | Phospholipase that may play a role in phospholipids remodeling. May selectively cleave myristate (C14)-containing phosphatidylcholines through its predominant phospholipase 1 activity, cleaving preferentially acyl groups in sn1 position. In parallel, may have a minor phospholipase 2 activity acting on acyl groups in position sn2. In addition to (C14)-containing phosphatidylcholines, may also act on other medium-chain-containing and oxidatively truncated phospholipids.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.