Rilpl1 (NM_021430) Mouse Recombinant Protein

SKU
TP506383
Purified recombinant protein of Mouse Rab interacting lysosomal protein-like 1 (Rilpl1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR206383 protein sequence
Red=Cloning site Green=Tags(s)

MEEPLGSPPAALSALEKNVAELTVMDVYDIASLVGHEFERVIDQHGCESIARLMPKVVRVLEILEVLVSR
HHVAPELDELRLELDRLRVERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLNHK
DVGFSEEEFQKQEGMSERERQVMKRLKEVVDKQRDELRAKDRELGLKNEDVEALQQQQTRLMKINHDLRH
RVTVVEAQGKALIEQKVELEADLQTKEQEMGSLRAELGKLRERLQGEHSQNGEEEEAEIQPQPDGEESIS
DAEKAALDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEIEEENRIPQPPPITHPRTSP
QPESGIKRLFSFFSRDKKRLANTQRPTHIHESFGQWAITQRDDGYTEQGQEALQHL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 47.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_067405
Locus ID 75695
UniProt ID Q9JJC6
Cytogenetics 5 F
RefSeq Size 2281
RefSeq ORF 1218
Synonyms 2900002H16Rik; 6330559I19Rik; GOSPEL
Summary Neuroprotective protein, which acts by sequestring GAPDH in the cytosol and prevent the apoptotic function of GAPDH in the nucleus. Competes with SIAH1 for binding GAPDH. Does not regulate lysosomal morphology and distribution (By similarity). Plays a role in the regulation of cell shape and polarity. Plays a role in cellular protein transport, including protein transport away from primary cilia.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Rilpl1 (NM_021430) Mouse Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.