Rilpl1 (NM_021430) Mouse Recombinant Protein
SKU
TP506383
Purified recombinant protein of Mouse Rab interacting lysosomal protein-like 1 (Rilpl1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Mouse |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>MR206383 protein sequence
Red=Cloning site Green=Tags(s) MEEPLGSPPAALSALEKNVAELTVMDVYDIASLVGHEFERVIDQHGCESIARLMPKVVRVLEILEVLVSR HHVAPELDELRLELDRLRVERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLNHK DVGFSEEEFQKQEGMSERERQVMKRLKEVVDKQRDELRAKDRELGLKNEDVEALQQQQTRLMKINHDLRH RVTVVEAQGKALIEQKVELEADLQTKEQEMGSLRAELGKLRERLQGEHSQNGEEEEAEIQPQPDGEESIS DAEKAALDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEIEEENRIPQPPPITHPRTSP QPESGIKRLFSFFSRDKKRLANTQRPTHIHESFGQWAITQRDDGYTEQGQEALQHL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 47.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_067405 |
Locus ID | 75695 |
UniProt ID | Q9JJC6 |
Cytogenetics | 5 F |
RefSeq Size | 2281 |
RefSeq ORF | 1218 |
Synonyms | 2900002H16Rik; 6330559I19Rik; GOSPEL |
Summary | Neuroprotective protein, which acts by sequestring GAPDH in the cytosol and prevent the apoptotic function of GAPDH in the nucleus. Competes with SIAH1 for binding GAPDH. Does not regulate lysosomal morphology and distribution (By similarity). Plays a role in the regulation of cell shape and polarity. Plays a role in cellular protein transport, including protein transport away from primary cilia.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.