Cct6a (BC018459) Mouse Recombinant Protein

SKU
TP506068
Purified recombinant protein of Mouse chaperonin subunit 6a (zeta) (cDNA clone MGC:11850 IMAGE:3597455), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR206068 protein sequence
Red=Cloning site Green=Tags(s)

MDRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIRKKDEPIDLFMVEIMEMKHKSETDTSLIRGLVL
DHGARHPDMKKRVENAYILTCNVSLEYEKTEVNSGFFYKSAEEREKLVKAERKFIEDRVKKIIELKKKVC
GDSDKGFVVINQKGIDPFSLDALAKEGIVALRRAKRRNMERLTLACGGIALNSFDDLNPDCLGHAGLVYE
YTLGEEKFTFIEKCNNPRSVTLLVKGPNKHTLTQIKDAIRDGLRAVKNAIDDGCVVPGAGAVEVALAEAL
IKYKPSVKGRAQLGVQAFADALLIIPKVLAQNSGFDLQETLVKVQAEHSESGQLVGVDLSTGEPMVAAEM
GVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLKG

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 42.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
Locus ID 12466
UniProt ID P80317
Cytogenetics 5 G1.3
RefSeq Size 1795
RefSeq ORF 1167
Synonyms CCT-zeta; CCT-zeta-1; Cct6; Cctz-1; TCP-1-zeta
Summary Component of the chaperonin-containing T-complex (TRiC), a molecular chaperone complex that assists the folding of proteins upon ATP hydrolysis. The TRiC complex mediates the folding of WRAP53/TCAB1, thereby regulating telomere maintenance. The TRiC complex plays a role in the folding of actin and tubulin.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Cct6a (BC018459) Mouse Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.