B4galt6 (NM_019737) Mouse Recombinant Protein

SKU
TP505973
Purified recombinant protein of Mouse UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 6 (B4galt6), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR205973 protein sequence
Red=Cloning site Green=Tags(s)

MSALKRMMRVSNRSLIAFIFFFSLSTSCLYFIYVAPGIANTYLFMVQARGIMLRENVKTIGHMIRLYTNK
NTTLNGTDYPEGNNTSDYLVQTTTYLPQNFTYLPHLPCPEKLPYMRGFLSVNVSEISFDEVHQLFSKDSE
IGPGGHWRPKDCKPRWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNV
GFKEAMKDRAWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKI
NGFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYISIPHHHRGEVQFLGRYKLLRYSKERQYIDGL
NNLLYTPKILVDRLYTNISVNLMPELAPIEDY

myc-FLAG tag
Tag Myc-DDK
Predicted MW 44.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_062711
Locus ID 56386
UniProt ID Q9WVK5
Cytogenetics 18 A2
RefSeq Size 5808
RefSeq ORF 1146
Synonyms AA536803; AU022389
Summary Catalyzes the synthesis of lactosylceramide (LacCer) via the transfer of galactose from UDP-galactose to glucosylceramide (GlcCer) (PubMed:23882130, PubMed:30114188). LacCer is the starting point in the biosynthesis of all gangliosides (membrane-bound glycosphingolipids) which play pivotal roles in the CNS including neuronal maturation and axonal and myelin formation (PubMed:30114188).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:B4galt6 (NM_019737) Mouse Recombinant Protein
Your Rating
SKU Description Size Price
LC705973 B4galt6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY705973 Transient overexpression lysate of Mouse UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 6 (B4galt6) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.