Eif3h (NM_080635) Mouse Recombinant Protein

SKU
TP505355
Purified recombinant protein of Mouse eukaryotic translation initiation factor 3, subunit H (Eif3h), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR205355 protein sequence
Red=Cloning site Green=Tags(s)

MASRKEGTGSTATSSGSAGGAVGKGKGKGGSGDSAVKQVQIDGLVVLKIIKHYQEEGQGTEVVQGVLLGL
VVEDRLEITNCFPFPQHTEDDADFDEVQYQMEMMRSLRHVNIDHLHVGWYQSTYYGSFVTRALLDSQFSY
QHAIEESVVLIYDPIKTAQGSLSLKAYRLTPKLMEVCKEKDFSPEALKKASITFEHMFEEVPIVIKNSHL
INVLMWELEKKSAVADKHELLSLASSNHLGKSLQLLMDRVDEMSQDIIKYNTYMRNTSKQQQQKHQYQQR
RQQENMQRQSRGEPPLPEEDLSKLFKPHQAPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEY
NN

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 39.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_542366
Locus ID 68135
UniProt ID Q91WK2
Cytogenetics 15 C
RefSeq Size 1254
RefSeq ORF 1056
Synonyms 40kD; 1110008A16Rik; 9430017H16Rik; EIF3-gamma; EIF3-P40; Eif3s3
Summary Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Eif3h (NM_080635) Mouse Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.