Hmg20a (NM_025812) Mouse Recombinant Protein
SKU
TP505225
Purified recombinant protein of Mouse high mobility group 20A (Hmg20a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Mouse |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>MR205225 representing NM_025812
Red=Cloning site Green=Tags(s) MESLMASSTLPPLFADEDGSKESNDLATSGLTHPEGPYGSAATSTTNPEFVEDLSQGQLLQSEASNAVEG NEQRPEDEQRSKRGGWSKGRKRKKPLRDSNAPKSPLTGYVRFMNERREQLRAKRPEVPFPEITRMLGNEW SKLPPEEKQRYLDEADRDKERYMKELEQYQKTEAYKVFSRKTQDRQKGKSHRQDAARQATHDHEKETEVK ERSVFDIPIFTEEFLNHSKAREAELRQLRKSNMEFEERNAALQKHVESMRTAVEKLEVDVIQERSRNTVL QQHLETLRQMLTSSFASMPLPGSGEIPTVDTIDSYMNRLHSIILANPQDNENFIATVREVVNRLDR myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 39.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_080088 |
Locus ID | 66867 |
UniProt ID | Q9DC33 |
Cytogenetics | 9 B |
RefSeq Size | 3562 |
RefSeq ORF | 1038 |
Synonyms | 1200004E06Rik; 5730490E10Rik; Hmgxb1; Ibraf |
Summary | Plays a role in neuronal differentiation as chromatin-associated protein. Acts as inhibitor of HMG20B. Overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. Involved in the recruitment of the histone methyltransferase KMT2A/MLL1 and consequent increased methylation of histone H3 lysine 4.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.