Dhdds (NM_026144) Mouse Recombinant Protein
SKU
TP504923
Purified recombinant protein of Mouse dehydrodolichyl diphosphate synthase (Dhdds), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Mouse |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>MR204923 protein sequence
Red=Cloning site Green=Tags(s) MSWIKEGELSLWERFCANIIKAGPVPKHIAFIMDGNRRYAKKCQVERQEGHTQGFNKLAETLRWCLNLGI LEVTVYAFSIENFKRSKSEVDGLLDLARQKFSCLMEEQEKLQKHGVCIRVLGDLHLLPLDLQEKIAHAIQ ATKNYNKCFLNVCFAYTSRHEIANAVREMAWGVEQGLLEPSDVSESLLDKCLYSNHSPHPDILIRTSGEV RLSDFLLWQTSHSCLVFQPVLWPEYTFWNLCEAILQFQRNHGALQKARDMYAEERKRRQLERDQAAVTEQ LLREGLQASGDAQLRRTRLHKLSTKREERVQGFLKALELKRANWLALWGTASA myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 38.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_080420 |
Locus ID | 67422 |
UniProt ID | Q99KU1 |
Cytogenetics | 4 D3 |
RefSeq Size | 3110 |
RefSeq ORF | 999 |
Synonyms | 3222401G21Rik; CIT; DS; HDS; W91638 |
Summary | With NUS1, forms the dehydrodolichyl diphosphate synthase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Both subunits contribute to enzymatic activity, i.e. condensation of multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precursor of dolichol phosphate which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER). Regulates the glycosylation and stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.