Car5b (NM_019513) Mouse Recombinant Protein

SKU
TP504574
Purified recombinant protein of Mouse carbonic anhydrase 5b, mitochondrial (Car5b), nuclear gene encoding mitochondrial protein, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR204574 protein sequence
Red=Cloning site Green=Tags(s)

MAVMNHLRVILQVSSSTLPWRRCWVPRLVPRRSCSLYTCTYRTRNRALPPLWENLDLVPAGDRQSPINIR
WRDSVYDPGLKPLTISYDPATCLHIWNNGYSFLVEFEDSTDKSVVEGGPLEHNYRLKQFHFHWGAIDAWG
SEHTVDSKCYPAELHLVHWNAVKFESFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDTLV
EFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDRDQLEQFRTLLFTSEGEKEKRMVDN
FRPLQPLMNRTVRSSFRHDYVLNIQVKPKPTASEVTP

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 36.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
Locus ID 56078
UniProt ID Q9QZA0
Cytogenetics X F5
RefSeq Size 3465
RefSeq ORF 951
Synonyms CAVB, CarVb, 7330410H16Rik, D730005F19Rik
Summary Reversible hydration of carbon dioxide.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Car5b (NM_019513) Mouse Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.