Ttc33 (NM_026213) Mouse Recombinant Protein

SKU
TP503451
Purified recombinant protein of Mouse tetratricopeptide repeat domain 33 (Ttc33), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR203451 representing NM_026213
Red=Cloning site Green=Tags(s)

MASFGWKRRIGEKVSKATSQQFEAEAADEKDAAENEDGNWLQASKRRKETLQEGCKQRSQQLKDEGAQLA
ENKRYKEAIQKWDEALQLTPGDATLYEMKSQVLLSLHEMFPAVHAAEMAVKRNPHSWEAWQTLGRAQLGL
GEIVLAIRSFQIALHIYPMNPELWKEDLSWARKLQEQQKVAQRIENKEMPPEGPDLSPGSIPDYDFESDE
IVAVCAAVAEKQKSVSANKTMVIVSASGTVEIVNEKEEGSSTPDGSVFIKAR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 29.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_080489
Locus ID 67515
UniProt ID Q9D6K7
Cytogenetics 15 A1
RefSeq Size 1832
RefSeq ORF 786
Synonyms 2410099M07Rik; 2900001O04Rik; AI507072; AW538342; Osrf
Write Your Own Review
You're reviewing:Ttc33 (NM_026213) Mouse Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.