Kcnip3 (NM_019789) Mouse Recombinant Protein

SKU TP503287

Purified recombinant protein of Mouse Kv channel interacting protein 3, calsenilin (Kcnip3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203287 protein sequence; Red=Cloning site Green=Tags(s); ; MQRTKEAVKASDGNLLGDPGRIPLSKRESIKWQRPRFTRQALMRCCLIKWILSSAAPQGSDSSDSELELS; TVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYSQFFPQGDATTYAHFLFNAFDA; DGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDGCITKEEMLAIMKSIYDMMGRHTYPILREDA; PLEHVERFFQKMDRNQDGVVTIDEFLETCQKDENIMNSMQLFENVI; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 29.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_062763
• Locus ID: 56461
• UniProt ID: Q9QXT8
• Cytogenetics: 2 F1
• RefSeq Size: 2775
• RefSeq ORF: 768
• Synonyms: 4933407H12Rik; AI413860; Csen; DREAM; KChIP3; R74849
• Summary: Calcium-dependent transcriptional repressor that binds to the DRE element of genes including PDYN and FOS. Affinity for DNA is reduced upon binding to calcium and enhanced by binding to magnesium. Seems to be involved in nociception.[UniProtKB/Swiss-Prot Function]