C1qtnf5 (NM_001040631) Mouse Recombinant Protein

SKU
TP503019
Purified recombinant protein of Mouse C1q and tumor necrosis factor related protein 5 (C1qtnf5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR203019 protein sequence
Red=Cloning site Green=Tags(s)

MRPLLALLLLGLVSGSPPLDDNKIPSLCPGQPGLPGTPGHHGSQGLPGRDGRDGRDGAPGAPGEKGEGGR
PGLPGPRGEPGPRGEAGPMGAIGPAGECSVPPRSAFSAKRSESRVPPPADTPLPFDRVLLNEQGHFDPTT
GKFTCQVPGVYYFAVHATVYRASLQFDLVKNGQSIASFFQYFGGWPKPASLSGGAMVRLEPEDQVWVQVG
VGDYIGIYASIKTDSTFSGFLVYSDWHSSPVFA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 25.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001035721
Locus ID 235312
UniProt ID Q8K479
Cytogenetics 9 24.62 cM
RefSeq Size 1275
RefSeq ORF 729
Synonyms Adie; CTR; Ctrp5; Mfrp
Summary The protein encoded by this gene is a member of the C1q/tumor necrosis factor superfamily. This family member is a secretory protein that functions in eye development. Mutations in this gene are thought to underlie the pathophysiology of late-onset retinal degeneration (L-ORD) and early-onset long anterior zonules (LAZ). Bicistronic transcripts composed of the coding sequences for this gene (C1qtnf5) and the membrane-type frizzled-related protein gene (Mfrp) have been identified, and the resulting products can interact with each other. Co-transcription of C1qtnf5 and Mfrp has been observed in both human and mouse. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2010]
Write Your Own Review
You're reviewing:C1qtnf5 (NM_001040631) Mouse Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.