Igfbp6 (NM_008344) Mouse Recombinant Protein

SKU TP502918

Purified recombinant protein of Mouse insulin-like growth factor binding protein 6 (Igfbp6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202918 protein sequence; Red=Cloning site Green=Tags(s); ; MTWDGLPTQPLLMLLMLLFAAGSGSALAGCPGCGAGMQTGCRGGCVEEEDAGSPADGCTEAGGCLRREGQ; PCGVYSPKCAPGLQCQPRENEEAPLRALLIGQGRCQRARGPSEETTKESKPQGGASRSRDTNHRDRQKNP; RTSAAPIRPNPVQDSEMGPCRRHLDSVLQQLQTEVFRGGARGLYVPNCDLRGFYRKQQCRSSQGNRRGPC; WCVDPMGQPLPVSPDGQGSTQCSARSSG; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 25.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_032370
• Locus ID: 16012
• UniProt ID: P47880
• Cytogenetics: 15 F2
• RefSeq Size: 1305
• RefSeq ORF: 714
• Synonyms: IGFBP-6
• Summary: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.[UniProtKB/Swiss-Prot Function]