Syngr2 (NM_009304) Mouse Recombinant Protein

SKU TP502601

Purified recombinant protein of Mouse synaptogyrin 2 (Syngr2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202601 representing NM_009304; Red=Cloning site Green=Tags(s); ; MESGAYGAANAGGSFDLRRFLSQPQVVTRLVSMVLALIVFSCIFGEGYTNIHTSDQLYCVFNQNEDACRY; GSAIGVLAFLASAFFLVVDAFFSQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAATKPQDVRV; GADSARAAITFSFFSIFSWGVLASLAYQRYKAGVDAFIQNYVDPTPDPNTAYASYPSASVENYQQPPFTQ; NVETIEGYQPPPVY; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 25.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_033330
• Locus ID: 20973
• UniProt ID: O55101
• Cytogenetics: 11 E2
• RefSeq Size: 1527
• RefSeq ORF: 672
• Synonyms: cellugyrin; Clast2
• Summary: May play a role in regulated exocytosis. In neuronal cells, modulates the localization of synaptophysin/SYP into synaptic-like microvesicles and may therefore play a role in the formation and/or the maturation of this vesicles. May also play a role in GLUT4 storage and transport to the plasma membrane.[UniProtKB/Swiss-Prot Function]