Nfyb (NM_010914) Mouse Recombinant Protein

SKU TP502199

Purified recombinant protein of Mouse nuclear transcription factor-Y beta (Nfyb), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202199 representing NM_010914; Red=Cloning site Green=Tags(s); ; MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLPIANVARIMKN; AIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQK; FREAMKGEKGIGGAVSATDGLSEELTEEAFTNQLPAGLITADGQQQNVMVYTTSYQQISGVQQIQFS; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 23.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_035044
• Locus ID: 18045
• UniProt ID: P63139
• Cytogenetics: 10 40.25 cM
• RefSeq Size: 2552
• RefSeq ORF: 621
• Synonyms: AA985999; Cbf-A
• Summary: Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on its interacting cofactors.[UniProtKB/Swiss-Prot Function]