Nkiras2 (NM_028024) Mouse Recombinant Protein

SKU TP501833

Purified recombinant protein of Mouse NFKB inhibitor interacting Ras-like protein 2 (Nkiras2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201833 protein sequence; Red=Cloning site Green=Tags(s); ; MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAE; LPKHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAK; SEKVKLWEVSVADRRSLLEPFIYLASKMTQPQSKSAFPLSRKNKGSGSLDG; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 21.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_082300
• Locus ID: 71966
• UniProt ID: Q9CR56
• Cytogenetics: 11 D
• RefSeq Size: 2013
• RefSeq ORF: 573
• Synonyms: 2410003M04Rik; 4930527H08Rik; D630018G21Rik; KBRAS2
• Summary: Atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. May act by blocking phosphorylation of NFKBIB and nuclear localization of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB (By similarity).[UniProtKB/Swiss-Prot Function]