Ociad1 (NM_001159888) Mouse Recombinant Protein

SKU TP501797

Purified recombinant protein of Mouse OCIA domain containing 1 (Ociad1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201797 protein sequence; Red=Cloning site Green=Tags(s); ; MNGRADFREPNAQVSRPIPDIGGGYIPTEEEWRLFAECHEECFWFRSVPLAATSMLITQGLISKGILSSH; PKYGSIPKLLFACIVGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGELRRSSPPGHYTQKPKFDSNVSG; QSSFGTSPAADNIEKEALPRYEPIPFSASMNESTPTGITDHIAQGRNFS; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 20.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001153360
• Locus ID: 68095
• UniProt ID: Q9CRD0
• Cytogenetics: 5 C3.2
• RefSeq Size: 1421
• RefSeq ORF: 567
• Synonyms: 6030432N09Rik; AI481327; Asrij; AW557942; B230209J16Rik; BB021357; Emi2; Imi2; OCIA; TPA018
• Summary: Maintains stem cell potency (PubMed:23972987). Increases STAT3 phosphorylation and controls ERK phosphorylation (PubMed:23972987). May act as a scaffold, increasing STAT3 recruitment onto endosomes (PubMed:23972987).[UniProtKB/Swiss-Prot Function]