Cabp5 (NM_013877) Mouse Recombinant Protein
SKU
TP501486
Purified recombinant protein of Mouse calcium binding protein 5 (Cabp5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Mouse |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>MR201486 protein sequence
Red=Cloning site Green=Tags(s) MQFPMGPACIFLRKGIAEKQRERPLGQDELDELREAFLEFDKDQDGFISYKDLGNLMRTMGYMPTEMELT ELGQQIRMNLGGRVDFEDFVELMTPKLLAETAGMIGVQEMRDAFKEFDANGDGEITLAELQQAMQRLLGE KLTPREIAEVVQEADINGDGTVDFEEFVKMMSR myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 19.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_038905 |
Locus ID | 29865 |
UniProt ID | Q9JLK3 |
Cytogenetics | 7 A1 |
RefSeq Size | 1745 |
RefSeq ORF | 519 |
Summary | Inhibits calcium-dependent inactivation of L-type calcium channel and shifts voltage dependence of activation to more depolarized membrane potentials (PubMed:18586882). Involved in the transmission of light signals (PubMed:18586882). May positively regulate neurotransmitter vesicle endocytosis and exocytosis in a salt-dependent manner (PubMed:22039235). May play a role in the extension and network organization of neurites (PubMed:22039235).[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.