Cabp5 (NM_013877) Mouse Recombinant Protein

SKU TP501486

Purified recombinant protein of Mouse calcium binding protein 5 (Cabp5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201486 protein sequence; Red=Cloning site Green=Tags(s); ; MQFPMGPACIFLRKGIAEKQRERPLGQDELDELREAFLEFDKDQDGFISYKDLGNLMRTMGYMPTEMELT; ELGQQIRMNLGGRVDFEDFVELMTPKLLAETAGMIGVQEMRDAFKEFDANGDGEITLAELQQAMQRLLGE; KLTPREIAEVVQEADINGDGTVDFEEFVKMMSR; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 19.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_038905
• Locus ID: 29865
• UniProt ID: Q9JLK3
• Cytogenetics: 7 A1
• RefSeq Size: 1745
• RefSeq ORF: 519
• Summary: Inhibits calcium-dependent inactivation of L-type calcium channel and shifts voltage dependence of activation to more depolarized membrane potentials (PubMed:18586882). Involved in the transmission of light signals (PubMed:18586882). May positively regulate neurotransmitter vesicle endocytosis and exocytosis in a salt-dependent manner (PubMed:22039235). May play a role in the extension and network organization of neurites (PubMed:22039235).[UniProtKB/Swiss-Prot Function]