Cggbp1 (NM_178647) Mouse Recombinant Protein

SKU TP501375

Purified recombinant protein of Mouse CGG triplet repeat binding protein 1 (Cggbp1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201375 protein sequence; Red=Cloning site Green=Tags(s); ; MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKR; KAEFEEQNVRKKQRPLTASLQCNSPAQTEKASVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSI; PKSDQLRRAYLPDGYENENQLLSSQDC; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 18.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_848762
• Locus ID: 106143
• UniProt ID: Q8BHG9
• Cytogenetics: 16 C1.3
• RefSeq Size: 4382
• RefSeq ORF: 501
• Synonyms: AA960172; AL023996; AW045841
• Summary: Binds to nonmethylated 5'-d(CGG)(n)-3' trinucleotide repeats in the FMR1 promoter. May play a role in regulating FMR1 promoter (By similarity).[UniProtKB/Swiss-Prot Function]