Mtfp1 (NM_026443) Mouse Recombinant Protein

SKU TP501356

Purified recombinant protein of Mouse mitochondrial fission process 1 (Mtfp1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201356 representing NM_026443; Red=Cloning site Green=Tags(s); ; MSEQQRQGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVSSSYVLADAIDKGKKAGEVPSPE; AGRNTRMALAVVDTFVWQSLASVAIPGFTINRLCAASLYVLGTMTHWPPTVRKWTTTTLGLLAIPVIIHP; IDRSVDFLLDSSLRKLYPSVEKPSTP; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 18.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_080719
• Locus ID: 67900
• UniProt ID: Q9CRB8
• Cytogenetics: 11 A1
• RefSeq Size: 1397
• RefSeq ORF: 498
• Synonyms: 1700020C11Rik; 2610507A21Rik; AV005788; Mtp18
• Summary: Involved in the mitochondrial division probably by regulating membrane fission. Loss-of-function leads to apoptosis (By similarity).[UniProtKB/Swiss-Prot Function]