Cplx4 (NM_145493) Mouse Recombinant Protein

SKU TP501244

Purified recombinant protein of Mouse complexin 4 (Cplx4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201244 protein sequence; Red=Cloning site Green=Tags(s); ; MAFFVKNMISNQVKNLGFGGGSEEKKEEGGTSDPAAAKGMTREEYEEYQKQMIEEKMERDAAFTQKKAER; ACLRVHLRDKYRLPKSEMDETQIQLAGDDVDLPEDLRKMVDEDQDEEEEKDSILGQLQNLQNMDLDTIKE; KAQATFTEIKQSAEQKCSVM; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 18.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_663468
• Locus ID: 225644
• UniProt ID: Q80WM3
• Cytogenetics: 18 E1
• RefSeq Size: 1767
• RefSeq ORF: 480
• Synonyms: A930004D23Rik; CPXIV; Gm957
• Summary: Complexin that regulates SNARE protein complex-mediated synaptic vesicle fusion (PubMed:19386896). Required for the maintenance of synaptic ultrastructure in the adult retina (PubMed:19386896). Positively regulates synaptic transmission through synaptic vesicle availability and exocytosis of neurotransmitters at photoreceptor ribbon synapses in the retina (PubMed:15911881, PubMed:19386896, PubMed:27335398). Suppresses tonic photoreceptor activity and baseline 'noise' by suppression of Ca(2+) vesicle tonic release and the facilitation of evoked synchronous and asynchronous Ca(2+) vesicle release (PubMed:22694764, PubMed:27335398).[UniProtKB/Swiss-Prot Function]