Atp6v0c (NM_009729) Mouse Recombinant Protein

SKU TP501148

Purified recombinant protein of Mouse ATPase, H+ transporting, lysosomal V0 subunit C (Atp6v0c), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201148 representing NM_009729; Red=Cloning site Green=Tags(s); ; MADIKNNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGL; VVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEV; LGLYGLIVALILSTK; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 16.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_033859
• Locus ID: 11984
• UniProt ID: P63082
• Cytogenetics: 17 A3.3
• RefSeq Size: 1151
• RefSeq ORF: 465
• Synonyms: Atp6c; Atp6c2; Atp6l; Atpl; Atpl-rs1; PL16; VATL; Vma3
• Summary: Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.[UniProtKB/Swiss-Prot Function]