Lage3 (NM_025410) Mouse Recombinant Protein

SKU TP501021

Purified recombinant protein of Mouse L antigen family, member 3 (Lage3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201021 protein sequence; Red=Cloning site Green=Tags(s); ; MQTAHTGLSHTADGADGQTSRCCPGNAGTKAVIPSGAHPVGRALEASRNPSKRIVPLTQRPGSRHHRFAL; FVPFPTSLEAEIACGSLVPDVEPHRGLVGKELKVSGCMLEVRWISEDSRLLRLSIINFLDQLSLVVNTIQ; LFGPPVSC; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 15.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_079686
• Locus ID: 66192
• UniProt ID: Q9CR70
• Cytogenetics: X A7.3
• RefSeq Size: 760
• RefSeq ORF: 444
• Synonyms: 1110049G11Rik; Eso3; Itba2
• Summary: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. LAGE3 functions as a dimerization module for the complex.[UniProtKB/Swiss-Prot Function]