Hba-a1 (NM_008218) Mouse Recombinant Protein

SKU TP500921

Purified recombinant protein of Mouse hemoglobin alpha, adult chain 1 (Hba-a1), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200921 representing NM_008218; Red=Cloning site Green=Tags(s); ; MVLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALANA; AGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSK; YR; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 15.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for at least 3 months from receipt of products under proper storage and handling conditions.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_032244
• Locus ID: 15122
• UniProt ID: Q91VB8
• Cytogenetics: 11 18.86 cM
• RefSeq Size: 569
• RefSeq ORF: 426
• Synonyms: Hba; Hba1; Hbat1