Ppp1r11 (NM_029632) Mouse Recombinant Protein

SKU TP500757

Purified recombinant protein of Mouse protein phosphatase 1, regulatory inhibitor subunit 11 (Ppp1r11), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200757 protein sequence; Red=Cloning site Green=Tags(s); ; MAETGAGISETVTETTVTETTVTETTEPENQSLIMKLRKRKPEKKVEWSSDTVDNEHMGRRSSKCCCIYE; KPRAFGESSTESDEDEEEGCSHKHCVRGHRKGRRPTTPAPTPTTPPQPPDPSQPPPGPMQH; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 14.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_083908
• Locus ID: 76497
• UniProt ID: Q8K1L5
• Cytogenetics: 17 19.16 cM
• RefSeq Size: 1696
• RefSeq ORF: 393
• Synonyms: 1500041B02Rik; AV117883; Hcgv; Tcte5; Tctex-5; Tctex5
• Summary: Atypical E3 ubiquitin-protein ligase which ubiquitinates TLR2 at 'Lys-754' leading to its degradation by the proteasome. Plays a role in regulating inflammatory cytokine release and gram-positive bacterial clearance by functioning, in part, through the ubiquitination and degradation of TLR2 (PubMed:27805901). Inhibitor of protein phosphatase 1 (By similarity).[UniProtKB/Swiss-Prot Function]