Tax1bp3 (BC094314) Mouse Recombinant Protein

SKU TP500632

Purified recombinant protein of Mouse Tax1 (human T-cell leukemia virus type I) binding protein 3 (cDNA clone MGC:106646 IMAGE:5715687), complete, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200632 protein sequence; Red=Cloning site Green=Tags(s); ; MSYTPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAG; LQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 13.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• Locus ID: 76281
• UniProt ID: Q9DBG9
• Cytogenetics: 11 B4
• RefSeq Size: 1277
• RefSeq ORF: 372
• Synonyms: TIP-1, RP23-263M10.10
• Summary: May regulate a number of protein-protein interactions by competing for PDZ domain binding sites. Binds CTNNB1 and may thereby act as an inhibitor of the Wnt signaling pathway. Competes with LIN7A for KCNJ4 binding, and thereby promotes KCNJ4 internalization. May play a role in the Rho signaling pathway (By similarity).[UniProtKB/Swiss-Prot Function]