Pclaf (NM_026515) Mouse Recombinant Protein

SKU TP500414

Purified recombinant protein of Mouse PCNA clamp associated factor (Pclaf), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200414 protein sequence; Red=Cloning site Green=Tags(s); ; MVRTKANYVPGAYRKAVASQAPRKVLGSSTFVTNSSSSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRL; SPKESKKENQAPEEAGTSGLGKAKRKACPLQPDHRDDENE; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 12 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_080791
• Locus ID: 68026
• UniProt ID: Q9CQX4
• Cytogenetics: 9 C
• RefSeq Size: 2387
• RefSeq ORF: 330
• Synonyms: 2810417H13Rik; AA409629; mKIAA0101; Ns5apt9; Ns5atp9; p15(PAF); Paf; PAF15
• Summary: PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number (By similarity).[UniProtKB/Swiss-Prot Function]