Triap1 (NM_026933) Mouse Recombinant Protein

SKU
TP500110
Purified recombinant protein of Mouse TP53 regulated inhibitor of apoptosis 1 (Triap1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR200110 protein sequence
Red=Cloning site Green=Tags(s)

MNSVGEACTDMKREYDQCFNRWFAEKFLKGDGSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKE
KPENSS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 8.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_081209
Locus ID 69076
UniProt ID Q9D8Z2
Cytogenetics 5 F
RefSeq Size 1049
RefSeq ORF 228
Synonyms 1810015M01Rik; AU020874; AU043831; P53csv; Wf-1
Summary Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Likewise, the TRIAP1:PRELID3A complex mediates the transfer of phosphatidic acid (PA) between liposomes (in vitro) and probably functions as a PA transporter across the mitochondrion intermembrane space (in vivo). Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Triap1 (NM_026933) Mouse Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.