ARPIN-AP3S2 (NM_001199058) Human Recombinant Protein

SKU
TP331205
Recombinant protein of human C15orf38-AP3S2 readthrough (C15orf38-AP3S2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC231205 representing NM_001199058
Red=Cloning site Green=Tags(s)

MSRIYHDGALRNKAVQSVRLPGAWDPAAHQGGNGVLLEGELIDVSRHSILDTHGRKERYYVLYIRPSHIH
RRKFDAKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLVNKPELLALTESLTPDHTVAF
WMPESEMEVMELELGAGVRLKTRGDGPFLDSLAKLEAGTVTKCNFTGDGKTGASWTDNIMAQKCSKGAAA
EIREQGDGAEDEEWPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYATLYFVFCVDS
SESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEK
SEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 44.3
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001185987
Locus ID 100526783
UniProt ID A0A0A6YYH1
Cytogenetics 15q26.1
RefSeq ORF 1182
Synonyms ARPIN; C15orf38; C15orf38-AP3S2
Summary This locus represents naturally occurring read-through transcription between the neighboring C15orf38 (chromosome 15 open reading frame 38) and AP3S2 (adaptor-related protein complex 3, sigma 2 subunit) genes. The read-through transcript encodes a fusion protein that shares sequence identity with each individual gene product. [provided by RefSeq, Nov 2010]
Write Your Own Review
You're reviewing:ARPIN-AP3S2 (NM_001199058) Human Recombinant Protein
Your Rating
SKU Description Size Price
LC434204 C15orf38 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY434204 Transient overexpression lysate of C15orf38-AP3S2 readthrough (C15orf38-AP3S2) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.