C19orf81 (NM_001195076) Human Recombinant Protein

SKU
TP331045
Recombinant protein of human hypothetical protein LOC342918 (LOC342918), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC231045 representing NM_001195076
Red=Cloning site Green=Tags(s)

MQPEVEPVCFPAMGSPTMHRKAGALLMDLETPEEMQARSLGRPIKSSKQYLRQVIAEYEALDRELPCIRK
FPTPPASQPLCLCMETLPEEDFTHLEVLQALEAQLPGAMESGRVSSIRFENMNVICGTAGRRNRWLIAVT
DFQTRSRLLRSGLSPRGLAHQIVRHDDLLLGDYRLHLRRSLVRRRMLEALGAEPNEEA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.9
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001182005
Locus ID 342918
UniProt ID C9J6K1
Cytogenetics 19q13.33
RefSeq ORF 594
Write Your Own Review
You're reviewing:C19orf81 (NM_001195076) Human Recombinant Protein
Your Rating
SKU Description Size Price
LC434044 C19orf81 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY434044 Transient overexpression lysate of hypothetical protein LOC342918 (LOC342918) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.