EPB41L5 (NM_001184937) Human Recombinant Protein

SKU
TP330428
Recombinant protein of human erythrocyte membrane protein band 4.1 like 5 (EPB41L5), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC230428 representing NM_001184937
Red=Cloning site Green=Tags(s)

MLSFFRRTLGRRSMRKHAEKERLREAQRAATHIPAAGDSKSIITCRVSLLDGTDVSVDLPKKAKGQELFD
QIMYHLDLIESDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRVKFYSSEPNNLREELTRYLFV
LQLKQDILSGKLDCPFDTAVQLAAYNLQAELGDYDLAEHSPELVSEFRFVPIQTEEMELAIFEKWKEYRG
QTPAQAETNYLNKAKWLEMYGVDMHVVKARDGNDYSLGLTPTGVLVFEGDTKIGLFFWPKITRLDFKKNK
LTLVVVEDDDQGKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGK
TEYQTTKTNKARRSTSFERRPSKRYSRRTLQMKACATKPEELSVHNNVSTQSNGSQQAWGMRSALPVSPS
ISSAPVPVEIENLPQSPGTDQHDRKCIPLNIDLLNSPDLLEATIGDVIGASDTMETSQALNDVNVATRLP
GLGEPEVEYETLKDTSEKLKQLEMENSPLLSPRSNIDVNINSQEEVVKLTEKCLNNVIESPGLNVMRVPP
DFKSNILKAQVEAVHKVTKEDSLLSHKNANVQDAATNSAVLNENNVPLPKESLETLMLITPADSGSVLKE
ATDELDALLASLTENLIDHTVAPQVSSTSMITPRWIVPLWSHFGRRSCPEAEVFTDH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 78
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001171866
Locus ID 57669
UniProt ID Q9HCM4
Cytogenetics 2q14.2
RefSeq ORF 2061
Synonyms BE37; LULU; LULU1; YMO1; YRT
Summary May contribute to the correct positioning of tight junctions during the establishment of polarity in epithelial cells.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:EPB41L5 (NM_001184937) Human Recombinant Protein
Your Rating
SKU Description Size Price
LC412211 EPB41L5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433428 EPB41L5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412211 Transient overexpression lysate of erythrocyte membrane protein band 4.1 like 5 (EPB41L5) 100 ug
$436.00
LY433428 Transient overexpression lysate of erythrocyte membrane protein band 4.1 like 5 (EPB41L5), transcript variant 2 100 ug
$665.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.