CD99L2 (NM_001184808) Human Recombinant Protein

SKU
TP329656
Purified recombinant protein of Homo sapiens CD99 molecule-like 2 (CD99L2), transcript variant 4, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC229656 representing NM_001184808
Red=Cloning site Green=Tags(s)

MVAWRSAFLVCLAFSLATLVQRGSGDFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSG
LDLADALDDQDDGRRKPGIGGRGDGRYGSNDDPGSGMVAEPGTIAGVASALAMALIGAVSSYISYQQKKF
CFSIQQGLNADYVKGENLEAVVCEEPQVKYSTLHTQSAEPPPPPEPARI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 20.5
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001171737
Locus ID 83692
UniProt ID Q8TCZ2
Cytogenetics Xq28
RefSeq ORF 567
Synonyms CD99B; MIC2L1
Summary This gene encodes a cell-surface protein that is similar to CD99. A similar protein in mouse functions as an adhesion molecule during leukocyte extravasation. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:CD99L2 (NM_001184808) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH307079 CD99L2 MS Standard C13 and N15-labeled recombinant protein (NP_113650) 10 ug
$3,255.00
LC410504 CD99L2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432656 CD99L2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410504 Transient overexpression lysate of CD99 molecule-like 2 (CD99L2), transcript variant 1 100 ug
$436.00
LY432656 Transient overexpression lysate of CD99 molecule-like 2 (CD99L2), transcript variant 4 100 ug
$436.00
TP307079 Recombinant protein of human CD99 molecule-like 2 (CD99L2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720762 Purified recombinant protein of Human CD99 molecule-like 2 (CD99L2), transcript variant 1 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.