HIC5 (TGFB1I1) (NM_001164719) Human Recombinant Protein

SKU
TP328899
Recombinant protein of human transforming growth factor beta 1 induced transcript 1 (TGFB1I1), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC228899 protein sequence
Red=Cloning site Green=Tags(s)

MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAPPFSSSSGVLG
TGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLE
LDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGL
CGSCNKPIAGQVVTALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHK
MVTALGTHWHPEHFCCVSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISALSALWHP
DCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSALGRRFHPDHFTCTFCLRP
LTKGSFQERAGKPYCQPCFLKLFG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 47.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001158191
Locus ID 7041
UniProt ID O43294
Cytogenetics 16p11.2
RefSeq Size 1782
RefSeq ORF 1332
Synonyms ARA55; HIC-5; HIC5; TSC-5
Summary This gene encodes a coactivator of the androgen receptor, a transcription factor which is activated by androgen and has a key role in male sexual differentiation. The encoded protein is thought to regulate androgen receptor activity and may have a role to play in the treatment of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:HIC5 (TGFB1I1) (NM_001164719) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300761 TGFB1I1 MS Standard C13 and N15-labeled recombinant protein (NP_057011) 10 ug
$3,255.00
LC402475 TGFB1I1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431927 TGFB1I1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402475 Transient overexpression lysate of transforming growth factor beta 1 induced transcript 1 (TGFB1I1), transcript variant 2 100 ug
$436.00
LY431927 Transient overexpression lysate of transforming growth factor beta 1 induced transcript 1 (TGFB1I1), transcript variant 3 100 ug
$436.00
TP300761 Recombinant protein of human transforming growth factor beta 1 induced transcript 1 (TGFB1I1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.