HIC5 (TGFB1I1) (NM_001164719) Human Recombinant Protein
SKU
TP328899
Recombinant protein of human transforming growth factor beta 1 induced transcript 1 (TGFB1I1), transcript variant 3, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC228899 protein sequence
Red=Cloning site Green=Tags(s) MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAPPFSSSSGVLG TGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLE LDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGL CGSCNKPIAGQVVTALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHK MVTALGTHWHPEHFCCVSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISALSALWHP DCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSALGRRFHPDHFTCTFCLRP LTKGSFQERAGKPYCQPCFLKLFG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001158191 |
Locus ID | 7041 |
UniProt ID | O43294 |
Cytogenetics | 16p11.2 |
RefSeq Size | 1782 |
RefSeq ORF | 1332 |
Synonyms | ARA55; HIC-5; HIC5; TSC-5 |
Summary | This gene encodes a coactivator of the androgen receptor, a transcription factor which is activated by androgen and has a key role in male sexual differentiation. The encoded protein is thought to regulate androgen receptor activity and may have a role to play in the treatment of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009] |
Protein Families | Druggable Genome, Transcription Factors |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300761 | TGFB1I1 MS Standard C13 and N15-labeled recombinant protein (NP_057011) | 10 ug |
$3,255.00
|
|
LC402475 | TGFB1I1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431927 | TGFB1I1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402475 | Transient overexpression lysate of transforming growth factor beta 1 induced transcript 1 (TGFB1I1), transcript variant 2 | 100 ug |
$436.00
|
|
LY431927 | Transient overexpression lysate of transforming growth factor beta 1 induced transcript 1 (TGFB1I1), transcript variant 3 | 100 ug |
$436.00
|
|
TP300761 | Recombinant protein of human transforming growth factor beta 1 induced transcript 1 (TGFB1I1), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.