SCOC (NM_001153446) Human Recombinant Protein

SKU
TP328730
Recombinant protein of human short coiled-coil protein (SCOC), transcript variant 6, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC228730 protein sequence
Red=Cloning site Green=Tags(s)

MDGSRKEEEEDSTFTNISLADDIDHSSRILYPRPKSLLPKMMNADMDVDAENQVELEEKTRLINQVLELQ
HTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSKRK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 13.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001146918
Locus ID 60592
UniProt ID Q9UIL1
Cytogenetics 4q31.1
RefSeq Size 1876
RefSeq ORF 363
Synonyms HRIHFB2072; SCOCO; UNC-69
Summary This gene encodes a short coiled-coiled domain-containing protein that localizes to the Golgi apparatus. The encoded protein interacts with ADP-ribosylation factor-like proteins. Pseudogenes of this gene are found on chromosomes 1 and 14. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]
Write Your Own Review
You're reviewing:SCOC (NM_001153446) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309356 SCOC MS Standard C13 and N15-labeled recombinant protein (NP_115936) 10 ug
$3,255.00
LC410036 SCOC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431758 SCOC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410036 Transient overexpression lysate of short coiled-coil protein (SCOC), transcript variant 4 100 ug
$436.00
LY431758 Transient overexpression lysate of short coiled-coil protein (SCOC), transcript variant 6 100 ug
$436.00
TP309356 Recombinant protein of human short coiled-coil protein (SCOC), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.