TCP1 eta (CCT7) (NM_001166284) Human Recombinant Protein

SKU
TP328371
Purified recombinant protein of Homo sapiens chaperonin containing TCP1, subunit 7 (eta) (CCT7), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC228371 representing NM_001166284
Red=Cloning site Green=Tags(s)

MMVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAFRTATQLAVNKIKEIAVTVKKADKVEQRKLLEK
CAMTALSSKLISQQKAFFAKMVVDAVMMLDDLLQLKMIGIKKVQGGALEDSQLVAGVAFKKTFSYAGFEM
QPKKYHNPKIALLNVELELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGD
VATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEETQIGGERYNFFTGCPKA
KTCTFILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGA
YAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFEAFVWEPAMVRINALTAAS
EAACLIVSVDETIKNPRSTVDAPTAAGRGRGRGRPH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 50.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001159756
Locus ID 10574
UniProt ID Q99832
Cytogenetics 2p13.2
RefSeq ORF 1368
Synonyms CCTETA; CCTH; NIP7-1; TCP1ETA
Summary This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 5 and 6. [provided by RefSeq, Oct 2009]
Write Your Own Review
You're reviewing:TCP1 eta (CCT7) (NM_001166284) Human Recombinant Protein
Your Rating
SKU Description Size Price
LC416654 CCT7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422918 CCT7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431399 CCT7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416654 Transient overexpression lysate of chaperonin containing TCP1, subunit 7 (eta) (CCT7), transcript variant 1 100 ug
$436.00
LY422918 Transient overexpression lysate of chaperonin containing TCP1, subunit 7 (eta) (CCT7), transcript variant 2 100 ug
$436.00
LY431399 Transient overexpression lysate of chaperonin containing TCP1, subunit 7 (eta) (CCT7), transcript variant 3 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.