THAP4 (NM_001164356) Human Recombinant Protein

SKU TP328099

Recombinant protein of human THAP domain containing 4 (THAP4), transcript variant 2, 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC228099 representing NM_001164356; Red=Cloning site Green=Tags(s); ; MEPPKMNPVVEPLSWMLGTWLSDPPGAGTYPTLQPFQYLEEVHISHVGQPMLNFSFNSFHPDTRKPMHRE; CGFIRLKPDTNKVAFVSAQNTGVVEVEEGEVNGQELCIASHSIARISFAKEPHVEQITRKFRLNSEGKLE; QTVSMATTTQPMTQHLHVTYKKVTP; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001157828
• Locus ID: 51078
• UniProt ID: Q8WY91
• Cytogenetics: 2q37.3
• RefSeq ORF: 495
• Synonyms: CGI-36; Nb(III); PP238
• Summary: In vitro catalyzes the heme-based conversion of peroxynitrite into nitrate/NO3-. May be involved in the detoxification of peroxynitrite which is responsible for the nitration of L-free tyrosine (PubMed:30524950). Also selectively binds nitric oxide/NO in vitro (PubMed:30524950).[UniProtKB/Swiss-Prot Function]