FCGRT (NM_001136019) Human Recombinant Protein

SKU
TP327329
Recombinant protein of human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC227329 representing NM_001136019
Red=Cloning site Green=Tags(s)

MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEP
CGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEF
MNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKAR
PSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHA
GLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEA
QDADLKDVNVIPATA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 39.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001129491
Locus ID 2217
UniProt ID P55899
Cytogenetics 19q13.33
RefSeq ORF 1095
Synonyms alpha-chain; FCRN
Summary This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:FCGRT (NM_001136019) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300364 FCGRT MS Standard C13 and N15-labeled recombinant protein (NP_004098) 10 ug
$3,255.00
PH327329 FCGRT MS Standard C13 and N15-labeled recombinant protein (NP_001129491) 10 ug
$3,255.00
LC401327 FCGRT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427768 FCGRT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401327 Transient overexpression lysate of Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2 100 ug
$436.00
LY427768 Transient overexpression lysate of Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 1 100 ug
$436.00
TP300364 Recombinant protein of human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 1, 20 µg 20 ug
$737.00
TP721216 Purified recombinant protein of Human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.