HES4 (NM_001142467) Human Recombinant Protein

SKU
TP327268
Recombinant protein of human hairy and enhancer of split 4 (Drosophila) (HES4), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC227268 representing NM_001142467
Red=Cloning site Green=Tags(s)

MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKVGSRPGVRGATGGREGRGTQPVPDPQSSKPVMEK
RRRARINESLAQLKTLILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAALSADPAVLGKYRAGF
HECLAEVNRFLAGCEGVPADVRSRLLGHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGG
PFPLLAPPLLPGLTRALPAAPRAGPQGPGGPWRPWLR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 25.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001135939
Locus ID 57801
UniProt ID Q9HCC6
Cytogenetics 1p36.33
RefSeq ORF 741
Synonyms bHLHb42
Summary Transcriptional repressor. Binds DNA on N-box motifs: 5'-CACNAG-3' (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:HES4 (NM_001142467) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH327268 HES4 MS Standard C13 and N15-labeled recombinant protein (NP_001135939) 10 ug
$3,255.00
LC412047 HES4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428113 HES4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412047 Transient overexpression lysate of hairy and enhancer of split 4 (Drosophila) (HES4), transcript variant 2 100 ug
$436.00
LY428113 Transient overexpression lysate of hairy and enhancer of split 4 (Drosophila) (HES4), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.