FXYD3 (NM_001136011) Human Recombinant Protein

SKU TP327235L

Recombinant protein of human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 7, 1 mg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC227235 protein sequence; Red=Cloning site Green=Tags(s); ; MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSG; HHPGETPPLITPGSAQS; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 7.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001129483
• Locus ID: 5349
• UniProt ID: Q14802
• Cytogenetics: 19q13.12
• RefSeq Size: 1466
• RefSeq ORF: 261
• Synonyms: MAT8; PLML
• Summary: This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Oct 2008]
• Protein Families: Ion Channels: Other, Transmembrane