NCR1 (NM_001145458) Human Recombinant Protein

CAT#: TP326814

Purified recombinant protein of Homo sapiens natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 3, 20 µg

Product Images

Coomassie blue staining of purified NCR1 protein (Cat# TP326814). The protein was produced from HEK293T cells transfected with NCR1 cDNA clone (Cat# RC226814) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC226814 representing NM_001145458
  Red=Cloning site Green=Tags(s)
  
  MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVD
  RPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKV
  TFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLV
  TGDIENTSLAPEDPTFPDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRR
  RLNTQTL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 32.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001138930
• Locus ID: 9437
• UniProt ID: O76036, A0A0A0MR94
• Cytogenetics: 19q13.42
• Refseq ORF: 861
• Synonyms: CD335; LY94; NK-p46; NKP46
• Summary: Cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Natural killer cell mediated cytotoxicity