NCR1 (NM_001145458) Human Mass Spec Standard

SKU
PH326814
NCR1 MS Standard C13 and N15-labeled recombinant protein (NP_001138930)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226814]
Predicted MW 32.4 kDa
Protein Sequence
Protein Sequence
>RC226814 representing NM_001145458
Red=Cloning site Green=Tags(s)

MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVD
RPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKV
TFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLV
TGDIENTSLAPEDPTFPDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRR
RLNTQTL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138930
RefSeq ORF 861
Synonyms CD335; LY94; NK-p46; NKP46
Locus ID 9437
UniProt ID O76036
Cytogenetics 19q13.42
Summary Cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Natural killer cell mediated cytotoxicity
Write Your Own Review
You're reviewing:NCR1 (NM_001145458) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417717 NCR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428900 NCR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417717 Transient overexpression lysate of natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 1 100 ug
$436.00
LY428900 Transient overexpression lysate of natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 2 100 ug
$436.00
TP326814 Purified recombinant protein of Homo sapiens natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.