Glutathione S Transferase kappa 1 (GSTK1) (NM_001143681) Human Recombinant Protein
CAT#: TP326807
Purified recombinant protein of Homo sapiens glutathione S-transferase kappa 1 (GSTK1), transcript variant 4, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226807 representing NM_001143681
Red=Cloning site Green=Tags(s) MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGSLSAMRFLTAVNLEHPEM LEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGL PITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001137153 |
Locus ID | 373156 |
UniProt ID | Q9Y2Q3 |
Cytogenetics | 7q34 |
Refseq ORF | 549 |
Synonyms | GST; GST13; GST 13-13; GST13-13; GSTK1-1; hGSTK1 |
Summary | This gene encodes a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. The encoded protein is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jan 2009] |
Protein Pathways | Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414320 | GSTK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428317 | GSTK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414320 | Transient overexpression lysate of glutathione S-transferase kappa 1 (GSTK1), transcript variant 1 |
USD 436.00 |
|
LY428317 | Transient overexpression lysate of glutathione S-transferase kappa 1 (GSTK1), transcript variant 4 |
USD 436.00 |
|
PH301467 | GSTK1 MS Standard C13 and N15-labeled recombinant protein (NP_057001) |
USD 3,255.00 |
|
PH326807 | GSTK1 MS Standard C13 and N15-labeled recombinant protein (NP_001137153) |
USD 3,255.00 |
|
TP301467 | Recombinant protein of human glutathione S-transferase kappa 1 (GSTK1), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review