Glutathione S Transferase kappa 1 (GSTK1) (NM_001143681) Human Mass Spec Standard

SKU
PH326807
GSTK1 MS Standard C13 and N15-labeled recombinant protein (NP_001137153)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226807]
Predicted MW 20.4 kDa
Protein Sequence
Protein Sequence
>RC226807 representing NM_001143681
Red=Cloning site Green=Tags(s)

MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGSLSAMRFLTAVNLEHPEM
LEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGL
PITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001137153
RefSeq ORF 549
Synonyms GST; GST13; GST 13-13; GST13-13; GSTK1-1; hGSTK1
Locus ID 373156
UniProt ID Q9Y2Q3
Cytogenetics 7q34
Summary This gene encodes a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. The encoded protein is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jan 2009]
Protein Pathways Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450
Write Your Own Review
You're reviewing:Glutathione S Transferase kappa 1 (GSTK1) (NM_001143681) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301467 GSTK1 MS Standard C13 and N15-labeled recombinant protein (NP_057001) 10 ug
$3,255.00
LC414320 GSTK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428317 GSTK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414320 Transient overexpression lysate of glutathione S-transferase kappa 1 (GSTK1), transcript variant 1 100 ug
$436.00
LY428317 Transient overexpression lysate of glutathione S-transferase kappa 1 (GSTK1), transcript variant 4 100 ug
$436.00
TP301467 Recombinant protein of human glutathione S-transferase kappa 1 (GSTK1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP326807 Purified recombinant protein of Homo sapiens glutathione S-transferase kappa 1 (GSTK1), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.