NKIRAS2 (NM_001144927) Human Recombinant Protein

SKU
TP326742
Purified recombinant protein of Homo sapiens NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC226742 protein sequence
Red=Cloning site Green=Tags(s)

MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAE
LPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAK
SEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 21.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001138399
Locus ID 28511
UniProt ID Q9NYR9
Cytogenetics 17q21.2
RefSeq Size 2493
RefSeq ORF 573
Synonyms kappaB-Ras2; KBRAS2
Summary Atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. May act by blocking phosphorylation of NFKBIB and nuclear localization of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:NKIRAS2 (NM_001144927) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309464 NKIRAS2 MS Standard C13 and N15-labeled recombinant protein (NP_060065) 10 ug
$3,255.00
PH323273 NKIRAS2 MS Standard C13 and N15-labeled recombinant protein (NP_001001349) 10 ug
$3,255.00
PH326742 NKIRAS2 MS Standard C13 and N15-labeled recombinant protein (NP_001138399) 10 ug
$3,255.00
LC413685 NKIRAS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424331 NKIRAS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425022 NKIRAS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428581 NKIRAS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413685 Transient overexpression lysate of NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 2 100 ug
$436.00
LY424331 Transient overexpression lysate of NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 1 100 ug
$436.00
LY428581 Transient overexpression lysate of NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 3 100 ug
$436.00
TP309464 Recombinant protein of human NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP323273 Recombinant protein of human NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.