TBXAS1 (NM_001130966) Human Recombinant Protein

SKU
TP325917
Recombinant protein of human thromboxane A synthase 1 (platelet) (TBXAS1), transcript variant TXS-III, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC225917 protein sequence
Red=Cloning site Green=Tags(s)

MMEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFRQGFWESQME
LRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVADSVLFLRDKRWEEVRGAL
MSAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPF
VKHCKRFFEFCIPRPILVLLLSFPSIMVPLARILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFL
QMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNT
LSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCE
VLGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLLEV
KLTLLHVLHKFRFQACPETQVPLQLESKSALGPKNGVYIKIVSR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 60.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001124438
Locus ID 6916
UniProt ID P24557
Cytogenetics 7q34
RefSeq Size 2385
RefSeq ORF 1602
Synonyms BDPLT14; CYP5; CYP5A1; GHOSAL; THAS; TS; TXAS; TXS
Summary This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to thromboxane A2, a potent vasoconstrictor and inducer of platelet aggregation. The enzyme plays a role in several pathophysiological processes including hemostasis, cardiovascular disease, and stroke. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]
Protein Families Druggable Genome, P450
Protein Pathways Arachidonic acid metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:TBXAS1 (NM_001130966) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308028 TBXAS1 MS Standard C13 and N15-labeled recombinant protein (NP_001052) 10 ug
$3,255.00
PH325917 TBXAS1 MS Standard C13 and N15-labeled recombinant protein (NP_001124438) 10 ug
$3,255.00
LC420741 TBXAS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427328 TBXAS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY420741 Transient overexpression lysate of thromboxane A synthase 1 (platelet) (TBXAS1), transcript variant 1 100 ug
$436.00
LY427328 Transient overexpression lysate of thromboxane A synthase 1 (platelet) (TBXAS1), transcript variant 3 100 ug
$436.00
TP308028 Recombinant protein of human thromboxane A synthase 1 (platelet) (TBXAS1), transcript variant TXS-I, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.